SAB2109206-100UL Display Image

ANTI-LHFPL4 (C-TERMINAL) ANTIBODY PRODUC

Code: SAB2109206-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


read more

Your Price
£364.00 100UL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human LHFPL4

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: LCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILN

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LHFPL4(57396)
mol wt27 kDa
NCBI accession no.NM_198560
shipped inwet ice
species reactivity (predicted by homology)guinea pig, zebrafish, bovine, mouse, rat, human, rabbit, canine
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria:



Quantity
Est. Dispatch/Availability