SAB2106205-100UL Display Image


Code: SAB2106205-100UL D2-231


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...

read more

Your Price
£466.00 100UL
£559.20 inc. VAT


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Synthetic peptide directed towards the N terminal of human HPS3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
concentration0.5 mg - 1 mg/mL
formbuffered aqueous solution
Gene Informationhuman ... HPS3(84343)rat ... Hps3(310288)
mol wt113 kDa
NCBI accession no.NM_001107664
Quality Level100
shipped inwet ice
species reactivityhuman, rabbit, guinea pig, mouse, horse, bovine, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q969F9
This product has met the following criteria: