SAB2104662-100UL Display Image

Anti-IRF7

Code: SAB2104662-100UL D2-231

Biochem/physiol Actions

IRF7 is interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in...


read more

Your Price
£459.00 100UL
Discontinued
£550.80 inc. VAT

Biochem/physiol Actions

IRF7 is interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human IRF7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... IRF7(3665)
mol wt56 kDa
NCBI accession no.NM_004031
Quality Level100
shipped inwet ice
species reactivityhuman, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q92985-4
This product has met the following criteria: