Biochem/physiol Actions

Membrane-associated progesterone receptor component 1 (UniProt: O00264; also known as mPR, PGRMC1) is encoded by the PGRMC1 (also known as HPR6.6, PGRMC) gene (Gene ID: 10857) in human. PGRMC1 is a single pass homodimeric membrane protein that is widely expressed with highest expression observed in liver and kidney. It is also shown to be overexpressed in multiple types of cancers and can serve as an important biomarker of their proliferative state. It has short N-terminal extracellular domain (aa 1-24), a transmembrane domain (aa 25-43), and a cytoplasmic domain (aa 44-195). PGRMC1 is a component of a progesterone-binding protein complex with many cellular functions. It is required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan. It also serves as an intracellular heme chaperone that regulates heme synthesis and acts as a heme donor for some hemoproteins. PGRMC1 contains a cytochrome b5 heme-binding domain (aa 72-171) that lacks the conserved iron-binding histidine residue at positions 107 and 131. PGRMC1 is reported to suppress p53 and Wnt/β-catenin pathway to promote self-renewal of pluripotent stem cells (PSCs) and inhibit their differentiation. Its levels are rapidly down regulated during early differentiation of PSCs. (Ref.: Kim, JY et al. (2018). Sci. Rep. 3; 3048; Kim, JY., et al. (2019). Sci. Rep. 9; 653).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human PGRMC1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ