Application

Rabbit Anti-TPI1 antibody has been used for western blot applications at a dilution of 1:1000.

Biochem/physiol Actions

TPI1 belongs to the triosephosphate isomerase family. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) . TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Triosephosphate isomerase 1 (TPI1) is an enzyme that catalyzes the isomerization of glyceraldehyde-3-phosphate and dihydroxy acetone phosphate during glycolysis and gluconeogenesis. Alterations in TPI1 gene have been linked to the deficiency of triosephosphate isomerase.Rabbit Anti-TPI1 antibody recognizes bovine, pig, rabbit, human, and canine TPI1.

Immunogen

Synthetic peptide directed towards the N terminal region of human TPI1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID