Anti-KCNAB2

Code: AV35461-100UL D2-231

Biochem/physiol Actions

This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxil...


read more

Your Price
£384.00 100UL
£460.80 inc. VAT

Biochem/physiol Actions

This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human KCNAB2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KCNAB2(8514)
mol wt39 kDa
NCBI accession no.NP_742128
Quality Level100
shipped inwet ice
species reactivitymouse, guinea pig, rabbit, horse, bovine, human, dog, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q13303-2
This product has met the following criteria to qualify for the following awards: