SAB5200940-100UG Display Image

MONOCLONAL ANTI-SUR2A - RPE

Code: SAB5200940-100UG D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


read more

Your Price
£530.00 100UG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Immunogen

Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Physical form

PBS pH7.4, 50% glycerol, 0.09% sodium azide

antibody formpurified immunoglobulin
antibody product typeprimary antibodies
biological sourcemouse
cloneS319A-14, monoclonal
concentration1 mg/mL
conjugatephycoerythrin (R-PE) conjugate
formbuffered aqueous solution
Gene Informationmouse ... Abcc9(20928)
isotypeIgG2a
mol wtantigen predicted mol wt 120 kDa
NCBI accession no.NP_001038185.1
Quality Level100
shipped inwet ice
species reactivityrat, mouse
storage temp.−20°C
technique(s)immunocytochemistry: suitable, western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q63563
This product has met the following criteria: