SAB2101257-100UL Display Image

Anti-KIF13B

Code: SAB2101257-100UL D2-231

Biochem/physiol Actions

KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUK...

read more

£411.00 100UL
List Price

Biochem/physiol Actions

KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human KIF13B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE

application(s)western blot: suitable
application(s)immunohistochemistry: suitable
clonepolyclonal
antibody formaffinity isolated antibody
mol wt203 kDa
Gene Informationhuman ... KIF13B(23303)
concentration0.5 mg - 1 mg/mL
UniProt accession no.Q9NQT8
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
species reactivityrabbit, guinea pig, human, mouse, dog, rat, bovine
formbuffered aqueous solution