SAB2100178-100UL Display Image

Anti-ATP10D

Code: SAB2100178-100UL D2-231

Biochem/physiol Actions

ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily.

Disclaimer

read more

£411.00 100UL
List Price

Biochem/physiol Actions

ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human ATP10D

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA

mol wt160 kDa
application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
UniProt accession no.Q9P241
Gene Informationhuman ... ATP10D(57205)
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
species reactivityhuman
formbuffered aqueous solution