SAB2100170-100UL Display Image

Anti-ATF6

Code: SAB2100170-100UL D2-231

Biochem/physiol Actions

ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.ATF6 is an ...

read more

£411.00 100UL
List Price

Biochem/physiol Actions

ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-171 AB015856.1 2-172 172-265 BC014969.1 124-217 266-336 AB015856.1 267-337 337-650 BC014969.1 289-602 651-1294 AF005887.1 626-1269 1295-2406 AB015856.1 1296-2407 2407-2488 AF005887.1 2375-2456

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ATF6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD

application(s)western blot: suitable
clonepolyclonal
UniProt accession no.P18850
antibody formaffinity isolated antibody
Gene Informationhuman ... ATF6(22926)
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
mol wt74 kDa
species reactivityhuman
formbuffered aqueous solution