AV48928-100UL Display Image

Anti-CXORF34

Code: AV48928-100UL D2-231

Application

Anti-CXORF34 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

<...


read more

Your Price
£377.00 100UL

Application

Anti-CXORF34 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

CXORF34 also known as tRNA methyltransferase 2 homolog B (TRMT2B) is an endo-exonuclease that is important for tRNA maturation and DNA double strand break repair.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human CXorf34

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CXorf34(79979)
mol wt56 kDa
NCBI accession no.NP_079193
Quality Level100
shipped inwet ice
species reactivitypig, dog, human, mouse, horse, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q96GJ1
Quantity
Est. Dispatch/Availability