Biochem/physiol Actions

SOX7 belongs to the SOX family of transcription factors bind PS4A and differentially modulate transcription. It is a potent activator of Fgf-3 transcription.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse SOX7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKSSESRIRRPMNAFMV