Biochem/physiol Actions

RECQL5 is an important backup helicase that maintains the genomic stability. It displaces RAD51 from ssDNA and prevents aberrant homologous recombination. The expression of RECQL5 is significantly decreased in sporadic primary colorectal cancers and acts as a marker to identify these cancers that are susceptible to chemotherapy.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human RECQL5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD