Application

Rabbit Anti-TRAFD1 antibody can be used for western blot applications at a concentration of 1.0µg/ml. It can also be used for IHC applications at 4-8µg/ml.

Biochem/physiol Actions

TRAFD1 is a new candidate transcription factor.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

TRAFD1 is a zinc finger protein that mediates a negative feedback in response to increased immunological functions. Rabbit Anti-TRAFD1 antibody recognizes mouse, human, bovine, canine, and rat TRAFD1.

Immunogen

Synthetic peptide directed towards the C terminal region of human TRAFD1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG