SAB5200936-100UG Display Image


Code: SAB5200936-100UG D2-231


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...

read more

£455.00 100UG
List Price


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.


Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Physical form

PBS pH7.4, 50% glycerol, 0.09% sodium azide

application(s)western blot: suitable
application(s)immunocytochemistry: suitable
application(s)immunohistochemistry: suitable
cloneS319A-14, monoclonal
UniProt accession no.Q63563
antibody formpurified immunoglobulin
mol wtantigen predicted mol wt 120 kDa
storage temp.−20°C
Quality Level100
concentration1 mg/mL
species reactivityrat, mouse
Gene Informationmouse ... Abcc9(20928)
shipped inwet ice
antibody product typeprimary antibodies
conjugateFITC conjugate
biological sourcemouse
NCBI accession no.NP_001038185.1
formbuffered aqueous solution