Biochem/physiol Actions

Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. The GJB4 gene encodes connexin 30.3 (Cx30.3) A mutation in connexin 30.3 is causally involved in erythrokeratodermia variabilis (EKV), a mostly autosomal dominant disorder of keratinization.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Gap junction β-4, GJB4, is a transmembrane connexin protein. It is one of six molecules that make up gap junctions. It plays a role in cardiac and smooth muscle contraction. It has a molecular weight of 30 kDa.

Immunogen

Synthetic peptide directed towards the middle region of human GJB4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL