AV41682-100UL Display Image

Anti-FECH

Code: AV41682-100UL D2-231

Biochem/physiol Actions

Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synth...

read more

£312.00 100UL
List Price

Biochem/physiol Actions

Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human FECH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM

NCBI accession no.NP_000131
application(s)western blot: suitable
clonepolyclonal
antibody formIgG fraction of antiserum
concentration0.5 mg - 1 mg/mL
species reactivitymouse, rat, guinea pig, bovine, dog, human, rabbit, horse
Gene Informationhuman ... FECH(2235)
storage temp.−20°C
Quality Level100
UniProt accession no.Q8NAN0
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
formbuffered aqueous solution
mol wt47 kDa