Biochem/physiol Actions

The function of Anti-DDX49 has not yet been determined.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

DDX49 is a member of the DEAD (Asp-Glu-Ala-Asp) family of ATP-dependent RNA helicases. These proteins are found in all eukaryotic cells as well as in bacteria. They assist in RNA-protein complex remodeling.

Immunogen

Synthetic peptide directed towards the N terminal region of human DDX49

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR