AV34953-100UL Display Image

Anti-CACNB1

Code: AV34953-100UL D2-231

Application

Rabbit Anti-CACNB1 antibody is suitable for western blot applications at a concentration of 1 µg/ml.

Biochem/physiol Actions

The...

read more

£411.00 100UL
List Price

Application

Rabbit Anti-CACNB1 antibody is suitable for western blot applications at a concentration of 1 µg/ml.

Biochem/physiol Actions

The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CACNB1 codes for a member of the calcium channel beta subunit protein family. It is known to modulate G protein function. CACNB1 has been implicated in zebrafish paralysis indicating its role in neuronal functions.Rabbit Anti-CACNB1 antibody recognizes canine, rabbit, bovine, human, mouse, rat, and zebrafish CACNB1.

Immunogen

Synthetic peptide directed towards the N terminal region of human CACNB1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
UniProt accession no.Q02641
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
NCBI accession no.NP_000714
conjugateunconjugated
mol wt66 kDa
Gene Informationhuman ... CACNB1(782)
species reactivityguinea pig, rat, bovine, human, mouse, horse, dog, rabbit
formbuffered aqueous solution