AV41366-100UL Display Image

Anti-ASS

Code: AV41366-100UL D2-231

Biochem/physiol Actions

ASS catalyzes the penultimate step of the arginine biosynthetic pathway.The protein encoded by this gene catalyzes the penultimate step of the arginin...

read more

£312.00 100UL
List Price

Biochem/physiol Actions

ASS catalyzes the penultimate step of the arginine biosynthetic pathway.The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of ASS cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ASS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF

application(s)western blot: suitable
application(s)immunohistochemistry: suitable
clonepolyclonal
UniProt accession no.P00966
mol wt45 kDa
Gene Informationhuman ... ASS(445)
antibody formIgG fraction of antiserum
species reactivitygoat, human, bovine, horse, mouse, guinea pig, dog, rat
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
NCBI accession no.NP_446464
formbuffered aqueous solution