SAB2102057-100UL Display Image

Anti-RSF1

Code: SAB2102057-100UL D2-231

Biochem/physiol Actions

RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin...

read more

£396.00 100UL
List Price

Biochem/physiol Actions

RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H (MIM 603375).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human RSF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
species reactivitybovine, dog, human, pig, horse, rabbit
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
mol wt164 kDa
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
Gene Informationhuman ... RSF1(51773)
conjugateunconjugated
UniProt accession no.Q96T23
formbuffered aqueous solution