SAB2108094-100UL Display Image

ANTI-BBS5

Code: SAB2108094-100UL D2-231

Biochem/physiol Actions

BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, po...

read more

£361.00 100UL
List Price

Biochem/physiol Actions

BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.This gene encodes a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia. Alternate transcriptional splice variants have been observed but have not been fully characterized.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human BBS5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW

clonepolyclonal
species reactivitybovine, human, mouse, horse, guinea pig, rat
antibody formaffinity isolated antibody
application(s)immunoblotting: suitable
NCBI accession no.NM_152384
concentration0.5 mg - 1 mg/mL
mol wt39kDa
storage temp.−20°C
Quality Level100
UniProt accession no.Q8N3I7
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
Gene Informationhuman ... BBS5(129880)
formbuffered aqueous solution